PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN23482.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 533aa    MW: 58736.3 Da    PI: 4.7535
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN23482.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.6e-183784148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed++lvd+vk++G g+W+++ ++ g+ R++k+c++rw ++l
       KHN23482.1 37 KGPWTSTEDDILVDYVKKHGEGNWNAVQKHTGLLRCGKSCRLRWANHL 84
                     79******************************99**********9986 PP

2Myb_DNA-binding48.52e-1590133146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+  ++++++++G++ W++ a++++ gRt++++k++w++
       KHN23482.1  90 KGAFTAEEERVIAELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 133
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.1043284IPR017930Myb domain
SuperFamilySSF466891.27E-2936131IPR009057Homeodomain-like
SMARTSM007178.4E-153686IPR001005SANT/Myb domain
PfamPF002493.7E-163784IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-233890IPR009057Homeodomain-like
CDDcd001671.20E-113984No hitNo description
PROSITE profilePS5129423.37785139IPR017930Myb domain
SMARTSM007172.4E-1589137IPR001005SANT/Myb domain
PfamPF002492.9E-1490133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.9E-2591137IPR009057Homeodomain-like
CDDcd001675.58E-1192133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MRQMKIDIED EVLPNDMSGT QLNDESYEGG AGIVLKKGPW TSTEDDILVD YVKKHGEGNW  60
NAVQKHTGLL RCGKSCRLRW ANHLRPNLKK GAFTAEEERV IAELHAKMGN KWARMAAHLP  120
GRTDNEIKNY WNTRIKRCQR AGLPLYPPEV SLQALQESQH SQSSGGLNGG EKMHPDFLQK  180
NSFEIHDGIF DSLKDNQGIL PYVHELSDIS VYGNMLKGLD SSQYCSFVPP TLPKCKRLKE  240
STIPFIDSCD MKKYDLYSFD QIRDNNSNKI AQSFGMQAPL DPGPSSHSSM CYSHSLSNGN  300
SSTSKPYEAV KLELPSLQYP ELDLGSWGSS PPPSLLESVD DFLQSPTPIS TLESDCSSPQ  360
NSGLLDALLY QAKTMSSSKN HCSDKSSNSS TATPGDRADS SALNVYETEW EDYADPVSPF  420
GATSILNECT GLRANMNSLN EQLPVQTITG DLPNLESVDQ VWTPDSENQT LSLLNNTCPD  480
FLLTSDWYDL GSGHGKNQAI STDAATAFLG DDLATDHKYM TAGTSITMFG NPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-32351375106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU3283980.0EU328398.1 Glycine max GAMYB protein (GAMYB) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006598058.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_006598061.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_014622864.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A0B2QV040.0A0A0B2QV04_GLYSO; Transcription factor GAMYB
TrEMBLK7MD720.0K7MD72_SOYBN; Uncharacterized protein
STRINGGLYMA15G35860.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-108myb domain protein 33
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]